Product category:
Proteomics
News Release from: AnaSpec | Subject: Catalogue peptides
Edited by the Laboratorytalk Editorial
Team on 14 February 2008
Yet more catalogue peptides from Anaspec
This week AnaSpec, one of the world's largest providers of custom and catalog peptides, introduced thirty-six (36) new catalogue peptides
Beta-Amyloid (1-40) Binding Peptide- Cat# 62426 This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not to monomeric beta-Amyloid (1-40)
This article was originally published on Laboratorytalk on 22 Jan 2007 at 8.00am (UK)
Related stories
AnaSpec releases twelve new catalogue peptides
Seeking to secure its position as one of the top two providers of catalogue peptides in the world, this week AnaSpec introduced a selection of new peptides for drug discovery research
AnaSpec introduces 55 new catalogue peptides
This week AnaSpec, one of the world's largest providers of custom and catalogue peptides, introduced 55 new peptides for drug discovery research
This sequence represents new potential carrier molecules to deliver medicines to amyloid plaques in AD patients and to image plaques in AD brains.
The ability to directly target reagents to the amyloid form of the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make amyloid plaques less toxic, the delivery of amyloid-destroying molecules to eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation.
Sequence: DWGKGGRWRLWPGASGKTEA.
Further reading
In-house Fmoc and Boc amino acids available to all
AnaSpec, one of the world's largest suppliers of custom and catalogue peptides, has made its own line of standard and unusual amino acids publicly available
27 new catalogue peptides from Anaspec
This week AnaSpec, one of the world's largest providers of custom and catalogue peptides, introduced twenty-seven (27) new peptides for drug discovery research
Another 13 new catalogue peptides
AnaSpec, one of the world's largest providers of custom and catalogue peptides, has introduced 13 new peptides for drug discovery research, listed below
Beta-Amyloid (1-40) Binding Peptide, biotinylated- Cat# 62427.
This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not to monomeric beta-Amyloid (1-40).
This sequence represents new potential carrier molecules to deliver medicines to amyloid plaques in AD patients and to image plaques in AD brains.
The ability to directly target reagents to the amyloid form of the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make amyloid plaques less toxic, the delivery of amyloid-destroying molecules to eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation.
This sequence is biotinylated on the N-terminus.
Sequence: Biotin-DWGKGGRWRLWPGASGKTEA.
Beta-Amyloid (1-20)- Cat# 62456.
This is amino acids 1 to 20 fragment of the beta-Amyloid peptide.
Sequence: DAEFRHDSGYEVHHQKLVFF.
Biotin-LC-beta-Amyloid (1-16)- Cat# 62458.
This is amino acids 1 to 16 N-terminal fragment of the beta-Amyloid peptide, biotinylated through an LC spacer.
Sequence: Biotin-LC-DAEFRHDSGYEVHHQK.
Biotin-beta-Amyloid (1-15)- Cat# 62461.
This is amino acids 1 to 15 fragment of beta-Amyloid, labeled with Biotin at the N-terminus.
Sequence: Biotin-DAEFRHDSGYEVHHQ.
Beta-Amyloid(15-26)-Lys(Biotin)-NH2- Cat# 62469.
This is amino acids 15 to 26 fragment of the beta-Amyloid peptide biotinylated through the side chain of Lys at position 27.
Sequence: QKLVFFAEDVGS-K(Biotin)-NH2.
Beta-Amyloid (11-28)-Lys (Biotin)-NH2- Cat# 62472.
This is amino acids 11 to 28 fragment of the beta-Amyloid peptide biotinylated on the side chain of lysine.
Sequence: EVHHQKLVFFAEDVGSNK-K(Biotin)-NH2.
Beta-Amyloid (1-40), DAC-labeled- Cat# 61949-01.
This is amino acids 1 to 40 sequence of beta-Amyloid, labeled with DAC.
beta-Amyloid (1-40) together with beta-Amyloid (1-42) are two major C-terminal variants of the beta-Amyloid protein.
These beta-Amyloid peptides undergo post-secretory aggregation and deposition in the Alzheimer's disease brain.
This peptide is labeled with DAC, an excellent blue fluorescent dye.
Sequence: (7-Diethylaminocoumarin-3-yl)carbonyl-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV.
Innate Defense Regulator-1 (IDR-1)- Cat# 62514.
This peptide is an innate defense regulator (IDR-1).
IDR-1 acts through mitogen-activated protein kinase and other signaling pathways, enhances levels of monocyte chemokines while reducing pro-inflammatory cytokine responses.
IDR-1 counters infection by selective modulation of innate immunity.
It is protective against Gram-positive and Gram-negative pathogens in mouse models of infection.
Sequence: KSRIVPAIPVSLL.
Mundticin KS- Cat# 61917-05.
Mundticin KS is a bacteriocin produced by Enterococcus mundtii NFRI 7393 isolated from grass silage (Thailand).
It belongs to the mundticin family of mundticin KS (mun KS) and mundticin AT06 (ATO06) peptides known to be active against several strains of Enterococcus spp, Lactobacillus spp., and Listeria monocytogenes.
Sequence: KYYGNGVSCNKKGCSVDWGKAIGIIGNNSAANLATGGAAGWKS (Disulfide bridge: 9-14).
NOXA BH3, Peptide 2- Cat# 62403.
This NOXA peptide belongs to the group of inactivator BH3-only molecules.
NOXA and other BH3-only molecules differentially inactivate members of the anti-apoptotic Bcl-2 family.
NOXA specifically antagonizes Mcl-1 molecule.
Sequence: VPADLKDECAQLRRIGDKVNLRQKL.
PUMA BH3- Cat# 62404.
This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide.
PUMA together with Bcl-xL, and cytoplasmic p53 coordinates p53 functions.
PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53.
PUMA may be a direct mediator of p53-induced apoptosis.
Sequence: EEQWAREIGAQLRRMADDLNAQYER.
BAD (CT-1)- Cat# 62271.
This is a C- terminal sequence derived from the pro-apoptotic protein Bad, the death agonist.
Sequence: KKGLPRPKSAGTATQMRQSSSWTC-NH2.
Bad (103-127), human, all d-isomers- Cat# 62322.
This is amino acids 103 to 127 fragment of the Bad analog, the BCL2-antagonist.
This fragment is composed of all d- amino acids.
It is predicted to induce extensive apoptosis of breast cancer cells.
Sequence: NLWAAQRYGRELRRMSDEFVDSFKK.
BH3 BIM Peptide (52-71), human- Cat# 62439.
This amino acids 52 to 71 fragment of the BH3 domain of Bim that reportedly functions as direct.
Sequence: Ac-MRPEIWIAQELRRIGDEFNA.
HB-1 (26-41)- Cat# 62511.
This peptide, amino acids 26 to 41 fragment of B-cell leukemia-associated antigen HB-1, is a minimal polymorphic tumor-associated antigen (TAA) recognized by CD4+ clones from donors with B-cell acute lymphoblastic leukemia (B-ALL).
HB-1 is able to induce both CD4+ Th and CD8+ CTL responses, implicating that HB-1 is a suitable target for B-ALL - specific immunotherapy.
Sequence: EDDVYLRHSSSLTYRL.
BAFF-R (160-183)- Cat# 62523.
This is amino acids 160 to 183 fragment from the cytoplasmic domain of B cell-activating factor (BAFF), belonging to the TNF family receptor (BAFF-R).
It plays a role in autoimmunity after ligation with BAFF ligand (also called TALL-1, BLyS, THANK, or zTNF4).
BAFF/BAFF-R interactions are critical for B cell regulation.
Signaling from this ligand-receptor complex results in NF-kappa B activation.
Sequence: SVPVPATELGSTELVTTKTAGPEQ.
Alpha B-Crystallin (73-92)- Cat# 62411.
This peptide is amino acids 73 to 92 fragment of alpha B-crystallin.
It is involved in preventing the formation of light scattering aggregates by substrate proteins.
Within this sequence, amino acids 84 and 86 are essential for alpha B-crystallin to effectively prevent the aggregation of substrate proteins.
This peptide is involved in chaperone-like activity.
Sequence: DRFSVNLDVKHFSPEELKVK.
TAT-NSF700 Fusion Peptide- Cat# 62238.
This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein (TAT) domain fused to a 22 amino acid NSF domain.
TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL.
Lipid Membrane Translocating Peptide- Cat# 62397.
This is an all d-amino acids sequence of the lipid membrane translocating peptide.
It is a drug delivery peptide that is able to penetrate the lipid membranes.
Sequence: KKAAAVLLPVLLAAP.
Leptin (57-74)- Cat# 62521.
This peptide is amino acids 57 to 74 fragment of leptin.
It modulates body mass and food intake in animals.
Sequence: VTGLDFIPGLHPILTLSK.
Insulin Growth Factor Binding Protein 6 (IGFBP6 ), mouse- Cat# 62418.
This octapeptide belongs to the mouse insulin growth factor (IGF) binding protein 6 (IGFBP6).
There are 6 well-characterized IGFBPs.
They are not only carriers of IGFs, but also modulators of their activity.
IGFBPs are also important in cell growth.
Sequence: GPSEETTK.
Link N- Cat# 62518.
This peptide is cleaved from the N-terminus of the link protein component of cartilage proteoglycan A by stromelysins 1 and 2, gelatinase A, B, and collagenase.
It aggregates by the action of stromelysin.
This peptide can act as a growth factor and stimulate synthesis of proteoglycans and collagen in articular cartilage.
Sequence: DHLSDNYTLDHDRAIH.
HIV-1, Envelope Glycoprotein (187-203)- Cat# 62435.
This amino acids 187 to 203 fragment is derived from the V3 loop of the HIV gp120 envelope protein.
Sequence: RGPGRAFVTIGKIGNMR-NH2.
Preptin, Human Pro-Insulin Growth Factor II (69-80), human- Cat# 62430.
This sequence belongs to the human preptin.
Preptin is a recently isolated 34-amino acid peptide hormone that is co-secreted with insulin and amylin from the pancreatic beta-cells.
Preptin corresponds to Asp69-Leu102 of pro-insulin growth factor II (pro-IGF-II).
Increased circulating levels of a pro-IGF-II peptide complexed with IGF-binding protein-2 have been implicated in the high bone mass phenotype observed in patients with chronic hepatitis C infection.
Sequence: DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL.
Apolipoprotein J (215-222)- Cat# 62516.
This peptide is amino acids 215 to 222 fragment of apolipoprotein J.
This sequence is virtually homologous with the cytolysis inhibitor SP-40,40, and may have an inhibitory effect on complement-mediated cell lysis.
Apolipoproteins may be involved in the progression of focal segmental glomerulosclerosis (FSGS), as well as other forms of noninflammatory glomerulonephritis.
Sequence: RPHFFFPK.
Apolipoprotein L (306-316)- Cat# 62517.
This peptide is amino acids 306 to 316 fragment of apolipoprotein L that has been isolated from pancreatic exocrine cells.
Apolipoproteins play a role in the pathogenesis of focal segmental glomerulosclerosis (FSGS) and other glomerulopathies in vivo.
FSGS serum may be deficient in particular apolipoproteins that normally bind and protect the glomerular basement membrane against the putative permeability factor or its effects.
Sequence: VNEPSILEMSR.
epsilon-V1-2, epsilon-PKC Inhibitor, Cys-conjugated- Cat# 62187.
This peptide is the epsilon-PKC specific inhibitor.
Its inhibitory activity is based on epsilon-PKC translocation and MARCKS phosphorylation.
This peptide interferes with epsilon-PKC interaction with the anchoring protein epsilon-RACK.
This sequence contains a cysteine residue added on the C-terminus.
Sequence: EAVSLKPTC.
TRBP, Thyroid Hormone (TR)-binding Protein, biotinylated- Cat# 62287.
This peptide is a fragment of the thyroid hormone (TR)-binding protein (TRBP), the LXXLL motif, containing the Ser884 phosphorylation site, is a key residue for receptor selectivity.
This peptide interacts with nuclear receptors, and ligand-dependent interaction of nuclear receptors and co-activators is a critical step in nuclear receptor-mediated transcriptional regulation.
The LXXLL-binding affinity correlates with TRBP transcriptional activity.
Sequence: Biotin-KDVTLTSPLLVNLLQSDIS.
ERK 1/2 /MAP Kinase Substrate, FAM labeled- Cat# 62342.
This is a mitogen-activated protein (MAP) kinase substrate, also designated as peptide 4.
This peptide is labeled with FAM at the N-terminus.
It may be used to determine activation of p38, a member of MAP kinase family which acts as a switch for the transcriptional and translational regulation of a number of proteins, including the proinflammatory cytokines.
IPTSPITTTYFFFKKK is also known as an ERK1/2 substrate.
Sequence: 5-FAM-IPTSPITTTYFFFKKK.
Glycogen Synthase Kinase 3 alpha (GSK3a) (16-26), phosphorylated- Cat# 62354.
This peptide belongs to the amino acids 16 to 26 fragment of glycogen synthase kinase, and is phosphorylated at Ser21.
Sequence: RARTS-pS-FAEPG.
Dominant H2-Kd Ligand- Cat# 62510.
This peptide is a dominant H2-Kd ligand derived from the JAK1 tyrosine kinase.
MHC ligands can be generated directly by the proteasome in vivo.
The expression of the corresponding MHC molecule for this ligand is critical for its protection.
Sequence: SYFPEITHI.
Inter-alpha-trypsin inhibitor heavy chain 4, C-terminal fragment (H4CT)- Cat# 62252.
This peptide is a proteolytically derived C-terminal fragment from the proline-rich region (PRR) of human inter-alpha-trypsin inhibitor heavy chain 4 (ITIH4).
The fragmentation patterns within the PRR of human serum ITIH4 are associated with different cancer disease conditions and may hold important diagnostic information.
This sequence contains a cysteine residue added on the C-terminus.
Sequence: CLGLPGPPDVPDH.
Eukaryotic Translation Initiation Factor,4E b- Cat# 62372.
This peptide is an eukaryotic translation initiation factor 4E b, known as eIF4b.
The integrity of eukaryotic translation initiation factor (eIF) interactions in ribosomal pre-initiation complexes is critical for the proper regulation of GCN4 mRNA translation in response to amino acid availability.
Sequence: PGGTRIIYDRKFLMECRNSP.
Measles Virus Fusion Protein (288-302)- Cat# 62408.
This peptide is amino acids 288 to 302 fragment of the measles virus fusion protein (MV-F).
This fragment of the fusion (F) protein represents a putative T cell epitope.
This sequence of the MV-F protein Tb is common for most MHC class II including the mouse H2d haplotype.
Sequence: LSEIKGVIVHRLEGV.
Influenza Virus Nucleoprotein (277-286)- Cat# 62422.
This peptide is amino acids 277 to 286 fragment of the influenza virus nucleoprotein (NP).
The peptide shows a strong binding affinity to the I-Ab- influenza virus protein.
Sequence: PACVYGPAVA.
• AnaSpec: contact details and other news
• Email this article to a colleague
• Register for the free Laboratorytalk email newsletter
• Laboratorytalk Home Page

